PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10028435
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 219aa    MW: 24863 Da    PI: 6.7813
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10028435genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+ eEde+lv ++k +G g W++ ++  g+ R++k+c++rw +yl
      Lus10028435 14 KGAWSREEDERLVSYIKAHGEGGWRSLPKSAGLLRCGKSCRLRWMNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding52.79.7e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +Edel+++++ +lG++ W+ Ia +++ gRt++++k++w+++l
      Lus10028435  67 RGNFTCQEDELIIRLHSLLGNK-WSVIAGKLP-GRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.794961IPR017930Myb domain
SMARTSM007171.0E-111363IPR001005SANT/Myb domain
SuperFamilySSF466891.94E-2913108IPR009057Homeodomain-like
PfamPF002491.3E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-221568IPR009057Homeodomain-like
CDDcd001676.70E-91661No hitNo description
PROSITE profilePS5129426.10762116IPR017930Myb domain
SMARTSM007172.9E-1566114IPR001005SANT/Myb domain
PfamPF002495.5E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-2769116IPR009057Homeodomain-like
CDDcd001671.63E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MGRSPCCERA HTNKGAWSRE EDERLVSYIK AHGEGGWRSL PKSAGLLRCG KSCRLRWMNY  60
LRPDLKRGNF TCQEDELIIR LHSLLGNKWS VIAGKLPGRT DNEIKNYWNT HLKRKLLGKG  120
IDPLTHRQIG AEDEKEEEEE GNGSVFSEEV NEANDNSSGV GMSRERDEVA DEELNLELRM  180
CPPSPRRHGP MSRPLEEEGS SSAVMVEGRK YWLVDMIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-281311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006383085.12e-88hypothetical protein POPTR_0005s11410g
SwissprotP813932e-85MYB08_ANTMA; Myb-related protein 308
TrEMBLU5GHF42e-88U5GHF4_POPTR; Uncharacterized protein
STRINGVIT_03s0038g02310.t011e-84(Vitis vinifera)
STRINGPOPTR_0005s11410.12e-84(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.15e-82myb domain protein 4